Structure of PDB 1nwy Chain Q

Receptor sequence

>1nwyQ (length=130) Species: 1299 (Deinococcus radiodurans)

EQTFRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAE
DLLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLK
RLIPRARGSANIIKKRTSHITIIVAEKGNK

3D structure

• PDB: 1nwy Structural basis for the antibiotic activity of ketolides and azalides.
• Chain: Q
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	R62 S74 P108 G112	R58 S70 P104 G108

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1nwy, PDBe:1nwy, PDBj:1nwy
• PDBsum: 1nwy
• PubMed: 12623020
• UniProt: Q9RXJ7|RL22_DEIRA Large ribosomal subunit protein uL22 (Gene Name=rplV)