Structure of PDB 1n34 Chain Q

Receptor sequence

>1n34Q (length=104) Species: 274 (Thermus thermophilus) [Search protein sequence]

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
GGKA

3D structure

PDB

1n34 Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	P2 K3 S12 M15 Q16 K17 R25 L31 Y32 K34 S39 K40 K41 Y42 E61 S62 R63 P64 I65 S66 K67 R68 K69 R70 R72 K87 N94 Y95 L98 S99 K100 R101 G102 G103 K104 A105	P1 K2 S11 M14 Q15 K16 R24 L30 Y31 K33 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 K86 N93 Y94 L97 S98 K99 R100 G101 G102 K103 A104	PDBbind-CN: Kd=220uM

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1n34, PDBe:1n34, PDBj:1n34
PDBsum	1n34
PubMed	12464183
UniProt	P0DOY7\|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)