Structure of PDB 1j5e Chain Q

Receptor sequence

>1j5eQ (length=104) Species: 274 (Thermus thermophilus)

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
GGKA

3D structure

• PDB: 1j5e Structure of the 30S ribosomal subunit.
• Chain: Q
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Q	P2 K3 K14 M15 Q16 K17 T18 R25 L31 Y32 K34 R38 S39 K40 K41 Y42 E61 S62 R63 P64 I65 S66 K67 R68 K69 R70 R72 R91 N94 Y95 L98 S99 K100 G102 G103 K104 A105	P1 K2 K13 M14 Q15 K16 T17 R24 L30 Y31 K33 R37 S38 K39 K40 Y41 E60 S61 R62 P63 I64 S65 K66 R67 K68 R69 R71 R90 N93 Y94 L97 S98 K99 G101 G102 K103 A104

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1j5e, PDBe:1j5e, PDBj:1j5e
• PDBsum: 1j5e
• PubMed: 11014182
• UniProt: P0DOY7|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)