Structure of PDB 1i94 Chain Q

Receptor sequence
>1i94Q (length=104) Species: 274 (Thermus thermophilus) [Search protein sequence]
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEERY
KVGDVVEIIEARPISKRKRFRVLRLVEEGRLDLVEKYLVRRQNYASLSKR
GGKA
3D structure
PDB1i94 Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
ChainQ
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q P2 K14 Q16 L31 R38 S39 R63 P64 I65 S66 K67 Y95 K100 G103 K104 P1 K13 Q15 L30 R37 S38 R62 P63 I64 S65 K66 Y94 K99 G102 K103
BS02 MG Q R25 K37 R38 R24 K36 R37
BS03 MG Q S66 K67 R68 K69 S65 K66 R67 K68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i94, PDBe:1i94, PDBj:1i94
PDBsum1i94
PubMed11296217
UniProtP0DOY7|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]