Structure of PDB 1bos Chain Q

Receptor sequence
>1bosQ (length=69) Species: 12371 (Phage h30) [Search protein sequence]
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
TIKTNACHNGGGFSEVIFR
3D structure
PDB1bos Structure of the shiga-like toxin I B-pentamer complexed with an analogue of its receptor Gb3.
ChainQ
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLA Q D4218 W4234 D18 W34
BS02 GAL Q T4254 G4262 T54 G62
BS03 GLA Q T4231 N4232 R4233 G4262 F4263 T31 N32 R33 G62 F63
BS04 GLA Q R4233 W4234 N4235 R33 W34 N35
BS05 GAL Q D4217 F4230 G4260 D17 F30 G60
BS06 GLA Q N4215 T4221 E4228 G4260 N15 T21 E28 G60
Gene Ontology
Biological Process
GO:0019836 hemolysis by symbiont of host erythrocytes
GO:0098676 modulation of host virulence by virus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bos, PDBe:1bos, PDBj:1bos
PDBsum1bos
PubMed9485303
UniProtP69179|STXB_BPH19 Shiga-like toxin 1 subunit B (Gene Name=stxB)

[Back to BioLiP]