Structure of PDB 6t83 Chain Py

Receptor sequence

>6t83Py (length=183) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: Py
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Py	R3 Y4 G5 A6 R61 R62 N120 Q121 P123	R2 Y3 G4 A5 R60 R61 N119 Q120 P122
BS02	rna	Py	R18 Y21 R23 K27 N28 R30 Q34 N37 Q55 R62 S65 S66 I67 R69 A71 K74 G77 K80 R82 W83 P84 K86 Q96 N97 N101 H116 Q118 V119 Q121 R127 Y130 R131 H133 G134 N137 K138 Y139 E140 S141 R167 R171 Q172 G174 R175 R181 I182	R17 Y20 R22 K26 N27 R29 Q33 N36 Q54 R61 S64 S65 I66 R68 A70 K73 G76 K79 R81 W82 P83 K85 Q95 N96 N100 H115 Q117 V118 Q120 R126 Y129 R130 H132 G133 N136 K137 Y138 E139 S140 R166 R170 Q171 G173 R174 R180 I181

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t83, PDBe:6t83, PDBj:6t83
• PDBsum: 6t83
• PubMed: 31858614
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)