Structure of PDB 8rd8 Chain Pj

Receptor sequence
>8rd8Pj (length=81) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
MVVIRLARGGAKKRPFYQVVVADQRRARDGRYIENIGFFNPLAKESEEAV
RLNMEAYHAWIAKGAQPSDRVASLVRAYNKA
3D structure
PDB8rd8 A new family of bacterial ribosome hibernation factors
ChainPj
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Pj M1 V2 R5 L6 R8 G10 K12 K13 R14 F16 Y17 Q18 D23 Q24 R25 R26 R28 G30 R31 F38 K44 E47 R51 K63 G64 Q66 S68 R70 S73 R76 M1 V2 R5 L6 R8 G10 K12 K13 R14 F16 Y17 Q18 D23 Q24 R25 R26 R28 G30 R31 F38 K44 E47 R51 K63 G64 Q66 S68 R70 S73 R76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum8rd8
PubMed38355796
UniProtA0A0M4T275

[Back to BioLiP]