Structure of PDB 5it7 Chain PP

Receptor sequence

>5it7PP (length=180) Species: 28985 (Kluyveromyces lactis)

RYGATSTNPAKSASARGSYLRVSYKNTRETAQAISGWNLQKAQKYLDQVL
DHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAASNA
EAKGLDATRLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVVTE
KEEAVEKASEKKVARLSSRQRGRLATQKRI

3D structure

• PDB: 5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.
• Chain: PP
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	PP	R3 Y4 S16 A17 R18 Y21 R23 S25 Y26 K27 R30 Q34 K46 Q50 Q55 R62 F63 S65 S66 I67 R69 A71 Q72 K74 E75 T79 K80 R82 W83 P84 A85 K86 Q96 N97 S100 N101 Q118 V119 Q121 Q125 R126 R127 R128 T129 F130 R131 A132 H133 G134 R135 I136 N137 K138 Y139 E140 S141 R167 S169 S170 R171 Q172 G174 R175 T178 I182	R1 Y2 S14 A15 R16 Y19 R21 S23 Y24 K25 R28 Q32 K44 Q48 Q53 R60 F61 S63 S64 I65 R67 A69 Q70 K72 E73 T77 K78 R80 W81 P82 A83 K84 Q94 N95 S98 N99 Q116 V117 Q119 Q123 R124 R125 R126 T127 F128 R129 A130 H131 G132 R133 I134 N135 K136 Y137 E138 S139 R165 S167 S168 R169 Q170 G172 R173 T176 I180
BS02	rna	PP	Y4 G5 A6 R30 R61 R62 Q118 N120 Q121 P123	Y2 G3 A4 R28 R59 R60 Q116 N118 Q119 P121

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5it7, PDBe:5it7, PDBj:5it7
• PDBsum: 5it7
• PubMed: 27159451
• UniProt: Q6CXQ6