Structure of PDB 3jag Chain PP

Receptor sequence
>3jagPP (length=127) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
VEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLSRGLRRKQ
HSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFN
QVEIKPEMIGHYLGEFSITYKPVKHGR
3D structure
PDB3jag Structural basis for stop codon recognition in eukaryotes.
ChainPP
Resolution3.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna PP R18 S38 A39 R40 R42 R43 R44 R47 R51 K52 R59 K77 H79 R81 D82 Y97 N98 G99 K100 F102 Y115 G117 E118 T122 Y123 V126 H128 R15 S35 A36 R37 R39 R40 R41 R44 R48 K49 R56 K74 H76 R78 D79 Y94 N95 G96 K97 F99 Y112 G114 E115 T119 Y120 V123 H125
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jag, PDBe:3jag, PDBj:3jag
PDBsum3jag
PubMed26245381
UniProtG1U0Q2|RS15_RABIT Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]