Structure of PDB 7enc Chain PJ

Receptor sequence

>7encPJ (length=64) Species: 9823 (Sus scrofa)

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL
AHVDLIEKLLNYAP

3D structure

• PDB: 7enc Structures of the human Mediator and Mediator-bound preinitiation complex.
• Chain: PJ
• Resolution: 4.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	PJ	C7 C10 C44 C45	C7 C10 C44 C45

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 22:24:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7enc', asym_id = 'PJ', title = 'Structures of the human Mediator and Mediator-bound preinitiation complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7enc', asym_id='PJ', title='Structures of the human Mediator and Mediator-bound preinitiation complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0003899,0006351,0008270', uniprot = '', pdbid = '7enc', asym_id = 'PJ'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003899,0006351,0008270', uniprot='', pdbid='7enc', asym_id='PJ')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>