Structure of PDB 7enc Chain PI

Receptor sequence
>7encPI (length=114) Species: 9823 (Sus scrofa) [Search protein sequence]
VGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHE
VDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLY
YVCTAPHCGHRWTE
3D structure
PDB7enc Structures of the human Mediator and Mediator-bound preinitiation complex.
ChainPI
Resolution4.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN PI C17 C20 C39 C42 C6 C9 C28 C31
BS02 ZN PI C86 C89 C114 C119 C75 C78 C103 C108
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001193 maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006351 DNA-templated transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7enc, PDBe:7enc, PDBj:7enc
PDBsum7enc
PubMed33958484
UniProtP60899|RPB9_PIG DNA-directed RNA polymerase II subunit RPB9 (Gene Name=POLR2I)

[Back to BioLiP]