Structure of PDB 8ipb Chain PA

Receptor sequence

>8ipbPA (length=130) Species: 4565 (Triticum aestivum) [Search protein sequence]

MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSSELRHKYNVRSIPIR
KDDEVQVVRGTYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHP
SKVIVTKLKLDKDRKALLDRKARGRAADKA

3D structure

PDB

8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	PA	M1 K2 R3 N4 T8 S9 R11 K13 C14 R15 H18 A33 R39 R45 S46 R59 G60 T61 K63 R76 R86 K88 V89 N90 H99 S101 K102 K121 G124 R125	M1 K2 R3 N4 T8 S9 R11 K13 C14 R15 H18 A33 R39 R45 S46 R59 G60 T61 K63 R76 R86 K88 V89 N90 H99 S101 K102 K121 G124 R125
BS02	rna	PA	R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 Q71 V72 Y73 R74 R75 L110 D111 K112 D113 K115 R120	R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 Q71 V72 Y73 R74 R75 L110 D111 K112 D113 K115 R120

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links