Structure of PDB 6gzz Chain P4

Receptor sequence
>6gzzP4 (length=84) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQEA
3D structure
PDB6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainP4
Resolution4.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P4 M1 V2 R5 L6 R8 G10 S11 K12 H13 R18 D23 R25 K27 R28 K31 Y38 P41 R42 K50 V62 T69 R72 R75 R81 Q82 M1 V2 R5 L6 R8 G10 S11 K12 H13 R18 D23 R25 K27 R28 K31 Y38 P41 R42 K50 V62 T69 R72 R75 R81 Q82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
PDBsum6gzz
PubMed30301898
UniProtQ5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]