Structure of PDB 5vyc Chain P3

Receptor sequence

>5vycP3 (length=125) Species: 9606 (Homo sapiens) [Search protein sequence]

RTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKR
LRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKP
EMIGHYLGEFSITYKPVKHGRPGIG

3D structure

PDB

5vyc Crystal Structure of the Human Ribosome in Complex with DENR-MCT-1.

Chain

Resolution

6.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P3	A39 R40 R42 R43 R44 R50 R51 H79 R81 D82 Y97 G99 K100 F102 Y115 G117 E118 S120 I121 V126 H128 G129 R130 P131 G132 I133	A30 R31 R33 R34 R35 R41 R42 H70 R72 D73 Y88 G90 K91 F93 Y106 G108 E109 S111 I112 V117 H119 G120 R121 P122 G123 I124
BS02	rna	P3	T11 F12	T2 F3

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0097371	MDM2/MDM4 family protein binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000056	ribosomal small subunit export from nucleus
GO:0001649	osteoblast differentiation
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis
GO:0097421	liver regeneration
GO:1901798	positive regulation of signal transduction by p53 class mediator

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5vyc, PDBe:5vyc, PDBj:5vyc
PDBsum	5vyc
PubMed	28723557
UniProt	P62841\|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)