Structure of PDB 6gzz Chain P1

Receptor sequence

>6gzzP1 (length=117) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRK
RRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVR
EPQVFAELVERAKAAQG

3D structure

PDB

6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.

Chain

Resolution

4.13 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P1	P2 R3 A4 K5 T6 V8 R10 R11 K13 H14 K15 K16 K22 G23 Y24 W25 G26 L27 R28 S31 F32 R33 K34 E37 Y45 Y47 H49 K51 R53 R55 F57 W61 I62 N75 Y76 S77 I80 H81 R92 K93	P1 R2 A3 K4 T5 V7 R9 R10 K12 H13 K14 K15 K21 G22 Y23 W24 G25 L26 R27 S30 F31 R32 K33 E36 Y44 Y46 H48 K50 R52 R54 F56 W60 I61 N74 Y75 S76 I79 H80 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
PDBsum	6gzz
PubMed	30301898
UniProt	P60491\|RL20_THET8 Large ribosomal subunit protein bL20 (Gene Name=rplT)