Structure of PDB 9ax7 Chain P

Receptor sequence
>9ax7P (length=81) Species: 562 (Escherichia coli) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKA
3D structure
PDB9ax7 Structural analysis of noncanonical translation initiation complexes.
ChainP
Resolution2.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P M1 V2 R5 L6 R8 G10 K12 K13 R14 F16 Y17 Q18 D23 S24 R25 R28 G30 R31 I33 R35 F38 E47 Q63 G64 S68 R70 M1 V2 R5 L6 R8 G10 K12 K13 R14 F16 Y17 Q18 D23 S24 R25 R28 G30 R31 I33 R35 F38 E47 Q63 G64 S68 R70
External links