Structure of PDB 8y37 Chain P

Receptor sequence
>8y37P (length=102) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGA
PTVEGATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKI
NA
3D structure
PDB8y37 Synthetic macrolides overcoming MLS B K-resistant pathogens.
ChainP
Resolution2.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P G8 G9 K10 F21 E23 K24 K64 K69 K70 V73 Y76 K77 R78 R79 K80 N81 K83 R84 K85 K86 G87 H88 R89 Q90 Y92 G8 G9 K10 F21 E23 K24 K64 K69 K70 V73 Y76 K77 R78 R79 K80 N81 K83 R84 K85 K86 G87 H88 R89 Q90 Y92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y37, PDBe:8y37, PDBj:8y37
PDBsum8y37
PubMed38992047
UniProtQ7A0Q2|RL21_STAAW Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]