Structure of PDB 8wlq Chain P |
>8wlqP (length=73) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
VSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVS MQMGIQVRNKLVAAYQEVMSMQV |
|
PDB | 8wlq Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. |
Chain | P |
Resolution | 3.8 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
P |
F59 G62 E63 |
F28 G31 E32 |
|
|
|