Structure of PDB 8v84 Chain P

Receptor sequence

>8v84P (length=137) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

NPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIP
FRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDA
TKLYVSHIQVNQAPKESSPSHIELVVTEKEEAVAKAA

3D structure

PDB

8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	S16 R18 S20 Y21 R23 S25 F26 K27 R30 Q34 R62 F63 S65 S66 R69 R82 W83 K86 N97 N101 Q118 V119 N120 Q121 S141 A156 A158 K159	S7 R9 S11 Y12 R14 S16 F17 K18 R21 Q25 R53 F54 S56 S57 R60 R73 W74 K77 N88 N92 Q109 V110 N111 Q112 S117 A132 A134 K135
BS02	rna	P	R62 N120 Q121 P123 H145	R53 N111 Q112 P114 H121

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum	8v84
PubMed	38632236
UniProt	P05740\|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)