Structure of PDB 8uql Chain P

Receptor sequence
>8uqlP (length=99) Species: 562 (Escherichia coli) [Search protein sequence]
RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
3D structure
PDB8uql Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
ChainP
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P R9 D19 R37 P39 I40 P41 L42 P43 T44 R45 I53 S54 P55 H56 V57 N58 K59 A61 R62 R68 H70 R72 L73 R5 D15 R33 P35 I36 P37 L38 P39 T40 R41 I49 S50 P51 H52 V53 N54 K55 A57 R58 R64 H66 R68 L69
External links