Structure of PDB 8rg0 Chain P |
>8rg0P (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] |
ENVFGVCHIFASFNDTFVHVTDLSGRDESSPYAAMLAAQTALHIKLRATG GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDS |
|
PDB | 8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining |
Chain | P |
Resolution | 3.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
P |
S137 D138 |
S86 D87 |
|
|
|