Structure of PDB 8qsj Chain P

Receptor sequence
>8qsjP (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]
DPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRT
QHHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRC
LEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
3D structure
PDB8qsj Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
ChainP
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P R66 Y179 E180 R30 Y143 E144
BS02 rna P R85 T86 Q87 H88 H89 R108 W110 K113 R120 N121 W151 S155 D156 R49 T50 Q51 H52 H53 R72 W74 K77 R84 N85 W115 S119 D120
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
GO:0035928 rRNA import into mitochondrion
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qsj, PDBe:8qsj, PDBj:8qsj
PDBsum8qsj
PubMed38042949
UniProtQ9H0U6|RM18_HUMAN Large ribosomal subunit protein uL18m (Gene Name=MRPL18)

[Back to BioLiP]