Structure of PDB 8qpp Chain P

Receptor sequence
>8qppP (length=88) Species: 1423 (Bacillus subtilis) [Search protein sequence]
AVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKI
DEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAKQG
3D structure
PDB8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1
ChainP
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P A2 V3 K4 R6 L7 R9 M10 K13 K14 F17 R19 S25 R26 R29 G31 R32 P42 K45 T62 K65 S67 T69 R71 N72 M80 E81 A1 V2 K3 R5 L6 R8 M9 K12 K13 F16 R18 S24 R25 R28 G30 R31 P41 K44 T61 K64 S66 T68 R70 N71 M79 E80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
PDBsum8qpp
PubMed38177497
UniProtA0A063XHU4

[Back to BioLiP]