Structure of PDB 8qbl Chain P

Receptor sequence

>8qblP (length=309) Species: 469008 (Escherichia coli BL21(DE3))

SAEYLNTFRLRNLGLPVMNNLHDMSKATRISVETLRLLIYTADFRYRIYT
VEKKGPEKRMRTIYQPSRELKALQGWVLRNILDKLSSSPFSIGFEKHQSI
LNNATPHIGANFILNIDLEDFFPSLTANKVFGVFHSLGYNRLISSVLTKI
CCYKNLLPQGAPSSPKLANLICSKLDYRIQGYAGSRGLIYTRYADDLTLS
AQSMKKVVKARDFLFSIIPSEGLVINSKKTCISGPRSQRKVTGLVISQEK
VGIGREKYKEIRAKIHHIFCGKSSEIEHVRGWLSFILSVDSKSHRRLITY
ISKLEKKYG

3D structure

• PDB: 8qbl Retron-Eco1 assembles NAD + -hydrolyzing filaments that provide immunity against bacteriophages.
• Chain: P
• Resolution: 2.66 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.49: RNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	P	Y6 F10 R13 N14	Y4 F8 R11 N12
BS02	dna	P	E35 L39 Y42 F46 R47 R70 K73 A129 N130 K131 F133 V135 S138 S147 T150 K156 L172 I173 R180 G183 Y195 K211 T244 H280 G283 W284 F287	E33 L37 Y40 F44 R45 R68 K71 A127 N128 K129 F131 V133 S136 S145 T148 K154 L170 I171 R178 G181 Y193 K209 T242 H278 G281 W282 F285
BS03	rna	P	K56 I65 K73 R81 F96 Q100 Q161 G162 A163 P164 K230 T232 C233 R238 S239 Q240 V247 R257 K261 S286	K54 I63 K71 R79 F94 Q98 Q159 G160 A161 P162 K228 T230 C231 R236 S237 Q238 V245 R255 K259 S284

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003964 RNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006974 DNA damage response
• GO:0051607 defense response to virus

External links

• PDB: RCSB:8qbl, PDBe:8qbl, PDBj:8qbl
• PDBsum: 8qbl
• PubMed: 38788717
• UniProt: P23070|RT86_ECOLX Retron Ec86 reverse transcriptase (Gene Name=ret)