Structure of PDB 8pib Chain P

Receptor sequence
>8pibP (length=135) Species: 562 (Escherichia coli) [Search protein sequence]
MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPL
CPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYK
PEGAFEGFQAIFTEPDGEARCMLLLNLINKEIKHS
3D structure
PDB8pib Concerted transformation of a hyper-paused transcription complex and its reinforcing protein.
ChainP
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna P R11 G12 R40 R11 G12 R40
BS02 dna P K10 H20 R23 Q24 A71 T72 R73 G74 V75 K10 H20 R23 Q24 A71 T72 R73 G74 V75
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0001073 transcription antitermination factor activity, DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008494 translation activator activity
GO:0061980 regulatory RNA binding
Biological Process
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0045727 positive regulation of translation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pib, PDBe:8pib, PDBj:8pib
PDBsum8pib
PubMed38589445
UniProtP0AFW0|RFAH_ECOLI Transcription antitermination protein RfaH (Gene Name=rfaH)

[Back to BioLiP]