Structure of PDB 8ovj Chain P

Receptor sequence

>8ovjP (length=197) Species: 347515 (Leishmania major strain Friedlin)

GVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQR
LIKSRSNRAPISLSRIAVVMKRKAVFTAKSKAAPIAVVVGDVLDDVRMAR
IPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKS
GRESVRHFGASGVPGSHSKPYATNRGKETKRGRRTGRSYKRKAFRHV

3D structure

• PDB: 8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: P
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	G2 S9 K11 S12 R13 V14 H18 Y20 S21 K31 K34 S41 F44 K54 R56 N58 S65 R66 K72 R73 K74 L94 D95 D96 V97 R98 M99 R101 I102 P103 R111 S113 K114 S115 K141 N142 R147 R149 S151 R153 S155 R157 F159 H168 K170 Y172 N175 R176 G177 R185 K191 R192 A194	G1 S8 K10 S11 R12 V13 H17 Y19 S20 K30 K33 S40 F43 K53 R55 N57 S64 R65 K71 R72 K73 L93 D94 D95 V96 R97 M98 R100 I101 P102 R110 S112 K113 S114 K140 N141 R146 R148 S150 R152 S154 R156 F158 H167 K169 Y171 N174 R175 G176 R184 K190 R191 A193
BS02	rna	P	P165 R185 R188 S189 R196 H197	P164 R184 R187 S188 R195 H196

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
• PDBsum: 8ovj
• PubMed: 38722744
• UniProt: Q4QG98|RL18_LEIMA Large ribosomal subunit protein eL18 (Gene Name=RPL18-A)