Structure of PDB 8ovc Chain P |
>8ovcP (length=86) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence] |
MSSTQDRSQLDPEVDVEDVPSAEWGWSHMPIGVMHIGGLLSAAFLLVMMR GNHVGHVEDWFLIGFAAVIVALVGRNWWLRRRGWIR |
|
PDB | 8ovc Long-range charge transfer mechanism of the III 2 IV 2 mycobacterial supercomplex. |
Chain | P |
Resolution | 2.8 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
WUO |
P |
H70 W74 F75 V82 |
H56 W60 F61 V68 |
|
|
|
|