Structure of PDB 8osl Chain P

Receptor sequence
>8oslP (length=50) Species: 10090 (Mus musculus) [Search protein sequence]
AREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHM
3D structure
PDB8osl Cooperation between bHLH transcription factors and histones for DNA access.
ChainP
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna P S85 D117 L119 S6 D38 L40
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8osl, PDBe:8osl, PDBj:8osl
PDBsum8osl
PubMed37407816
UniProtQ9WTL8|BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1 (Gene Name=Bmal1)

[Back to BioLiP]