Structure of PDB 8oos Chain P

Receptor sequence
>8oosP (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
3D structure
PDB8oos Hexasome-INO80 complex reveals structural basis of noncanonical nucleosome remodeling.
ChainP
Resolution3.29 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna P Y39 S53 K122 Y10 S24 K93
BS02 dna P R30 K31 E32 S33 Y37 R1 K2 E3 S4 Y8
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002227 innate immune response in mucosa
GO:0006334 nucleosome assembly
GO:0019731 antibacterial humoral response
GO:0042742 defense response to bacterium
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0000786 nucleosome
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oos, PDBe:8oos, PDBj:8oos
PDBsum8oos
PubMed37384673
UniProtP62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I (Gene Name=H2BC4)

[Back to BioLiP]