Structure of PDB 8oki Chain P

Receptor sequence
>8okiP (length=48) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
VEAVYRCFKCGREVKLDLSITRDLRCPYCGSKILYKPRPKVPRRVKAI
3D structure
PDB8oki Structural basis of archaeal RNA polymerase transcription elongation and Spt4/5 recruitment
ChainP
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN P C8 C11 C27 C30 C7 C10 C26 C29
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0016779 nucleotidyltransferase activity
GO:0034062 5'-3' RNA polymerase activity
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oki, PDBe:8oki, PDBj:8oki
PDBsum8oki
PubMed38709902
UniProtQ8TZI3|RPO12_PYRFU DNA-directed RNA polymerase subunit Rpo12 (Gene Name=rpo12)

[Back to BioLiP]