Structure of PDB 8kd7 Chain P

Receptor sequence
>8kd7P (length=79) Species: 8355 (Xenopus laevis) [Search protein sequence]
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVT
YTEHAKRKTVTAMDVVYALKRQGRTLYGF
3D structure
PDB8kd7 Structural basis of nucleosome deacetylation and DNA linker tightening by Rpd3S histone deacetylase complex.
ChainP
Resolution3.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna P R35 I46 G48 R78 K79 R14 I25 G27 R57 K58
BS02 dna P T30 P32 R36 T9 P11 R15
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kd7, PDBe:8kd7, PDBj:8kd7
PDBsum8kd7
PubMed37666978
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]