Structure of PDB 8k5o Chain P

Receptor sequence

>8k5oP (length=63) Species: 1052 (Halorhodospira halochloris) [Search protein sequence]

MWKLWKFVDFRMTAVGFHLFFALLAFAVHFACISSERFNWLEGAPAAEYY
MDEDPGIWKRTSY

3D structure

PDB

8k5o Structural insights into the unusual core photocomplex from a triply extremophilic purple bacterium, Halorhodospira halochloris.

Chain

Resolution

2.42 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	P	W2 I57 W58	W2 I57 W58
BS02	peptide	P	D9 M12 G16 L19 F20 L23 F26 A27 F30 A31 S34	D9 M12 G16 L19 F20 L23 F26 A27 F30 A31 S34
BS03	A1LZM	P	L4 T13 G16 F17 F20	L4 T13 G16 F17 F20
BS04	A1LZM	P	M1 L4 W5 F17 F21	M1 L4 W5 F17 F21
BS05	A1LZM	P	H18 A22 A25 H29 W40	H18 A22 A25 H29 W40
BS06	A1LZM	P	F17 H18 F21 L24	F17 H18 F21 L24
BS07	A1LZM	P	F21 L24 A25 V28 H29 C32 F38	F21 L24 A25 V28 H29 C32 F38
BS08	A1LZM	P	A25 F26 H29	A25 F26 H29

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0046872	metal ion binding

External links