Structure of PDB 8j5k Chain P

Receptor sequence

>8j5kP (length=214) Species: 29205 (Stephanocyclus meneghinianus) [Search protein sequence]

SPRALPFGSAPATLDGSLVGDVGFDPIGFSTAPFASFNNPLYKEGDFMSD
LEWLREAELTHGRIAQLAVLGFIWPALFGTFPGNENFGGADAFSYVNPLE
AITHVPDLAIYQIVGGMAWVEYQRVIRIKEQGKNRVSGDIGLGYPGGWNP
FNLNYSPEEYAEKQLQEIKHCRLAMIGAFGLFFQALNSGTDIVSQLSPAF
AAPDYAAKAGYFLP

3D structure

PDB

8j5k Structural insights into photosystem II supercomplex and trimeric FCP antennae of a centric diatom Cyclotella meneghiniana.

Chain

Resolution

2.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	P	R37 F58	R3 F24
BS02	CLA	P	G54 D55 F58 L85 L88 R89 E92 H95 R206	G20 D21 F24 L51 L54 R55 E58 H61 R172
BS03	CLA	P	L101 A102 G105	L67 A68 G71
BS04	CLA	P	W87 A91 T94 H95 A152 E155	W53 A57 T60 H61 A118 E121
BS05	CLA	P	D173 L176 Y194 K197 Q198 Q200 E201	D139 L142 Y160 K163 Q164 Q166 E167
BS06	CLA	P	Q200 H204 L207	Q166 H170 L173
BS07	CLA	P	Q200 H204	Q166 H170
BS08	CLA	P	G214 Q218 N221	G180 Q184 N187
BS09	A86	P	A208 L215 Q218	A174 L181 Q184
BS10	DD6	P	F58 I61 F106 P132 M209	F24 I27 F72 P98 M175

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009536	plastid
GO:0016020	membrane
GO:0030076	light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8j5k, PDBe:8j5k, PDBj:8j5k
PDBsum	8j5k
PubMed	38071196
UniProt	B8BUU4

[Back to BioLiP]