Structure of PDB 8ity Chain P

Receptor sequence
>8ityP (length=232) Species: 9606 (Homo sapiens) [Search protein sequence]
MKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLESKK
LIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQC
FKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVELSMED
IETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVR
APCGLCPVFDDCHEGGEISPSNCIYMTEWLEF
3D structure
PDB8ity Structure of the SNAPc-bound RNA polymerase III preinitiation complex.
ChainP
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna P R110 P119 L120 R26 P35 L36
BS02 SF4 P P286 C287 C290 F293 C296 P304 C307 Y309 M310 P202 C203 C206 F209 C212 P220 C223 Y225 M226
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0032728 positive regulation of interferon-beta production
GO:0045087 innate immune response
GO:0045089 positive regulation of innate immune response
GO:0051607 defense response to virus
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ity, PDBe:8ity, PDBj:8ity
PDBsum8ity
PubMed37165065
UniProtQ9H1D9|RPC6_HUMAN DNA-directed RNA polymerase III subunit RPC6 (Gene Name=POLR3F)

[Back to BioLiP]