Structure of PDB 8i7j Chain P

Receptor sequence
>8i7jP (length=123) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]
RKRSFKTYSYKGVDLEKLLEMPTEDFVKLAPARVRRKFARGLSEKPAGLM
KKLRAAKLSAPENEKPAVVRTHLRNMIIVPEMIGSVVGVYNGKVFNQVEI
RPEMVGHYLGEFSITYTPVRHGR
3D structure
PDB8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit
ChainP
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P P38 A39 R40 R42 R43 R47 E51 L56 K59 R77 T78 H79 R81 N82 Y97 G99 K100 Y115 E118 T122 Y123 T124 V126 R127 H128 P31 A32 R33 R35 R36 R40 E44 L49 K52 R70 T71 H72 R74 N75 Y90 G92 K93 Y108 E111 T115 Y116 T117 V119 R120 H121
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i7j, PDBe:8i7j, PDBj:8i7j
PDBsum8i7j
PubMed
UniProtQ6CKV4

[Back to BioLiP]