Structure of PDB 8gy7 Chain P

Receptor sequence

>8gy7P (length=51) Species: 9606 (Homo sapiens) [Search protein sequence]

SYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSW
S

3D structure

PDB

8gy7 Structural basis of signaling regulation of the human melanocortin-2 receptor by MRAP1.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	P	S13 Y14 E15 Y16 Y17 L18 D19 Y20 L21	S1 Y2 E3 Y4 Y5 L6 D7 Y8 L9

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0030545	signaling receptor regulator activity
GO:0031780	corticotropin hormone receptor binding
GO:0031781	type 3 melanocortin receptor binding
GO:0031782	type 4 melanocortin receptor binding
GO:0031783	type 5 melanocortin receptor binding
GO:0042802	identical protein binding
GO:0070996	type 1 melanocortin receptor binding

	Biological Process
GO:0072659	protein localization to plasma membrane
GO:0106070	regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0106071	positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0106072	negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:1903077	negative regulation of protein localization to plasma membrane

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005886	plasma membrane
GO:0043231	intracellular membrane-bounded organelle

External links

PDB	RCSB:8gy7, PDBe:8gy7, PDBj:8gy7
PDBsum	8gy7
PubMed	36588120
UniProt	Q8TCY5\|MRAP_HUMAN Melanocortin-2 receptor accessory protein (Gene Name=MRAP)