Structure of PDB 8ev3 Chain P

Receptor sequence

>8ev3P (length=148) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

VRYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNV
KEHKQAVPFRRFNGGVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEAN
AEAKGLDMDKLIIKHVQVNAAPKQAYLSSPSHIEIIVAEEEEAVPKAN

3D structure

PDB

8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	Y4 K16 R18 Y21 H25 F26 K27 R30 R62 F63 G65 G66 K74 R82 W83 K86 N97 A100 N101 H116 Q118 V119 K124 A138 Y139	Y3 K15 R17 Y20 H24 F25 K26 R29 R61 F62 G64 G65 K73 R81 W82 K85 N96 A99 N100 H115 Q117 V118 K123 A125 Y126
BS02	rna	P	R3 S5 R61 N120 A121 P123 H145	R2 S4 R60 N119 A120 P122 H132

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum	8ev3
PubMed	36423630
UniProt	O14339\|RL17A_SCHPO Large ribosomal subunit protein uL22A (Gene Name=rpl1701)

[Back to BioLiP]