Structure of PDB 8euy Chain P

Receptor sequence

>8euyP (length=145) Species: 4896 (Schizosaccharomyces pombe)

VRYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNV
KEHKQAVPFRRFNGGVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEAN
AEAKGLDMDKLIIKHVQVNAAPKQSSPSHIEIIVAEEEEAVPKAN

3D structure

• PDB: 8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: P
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 Y4 K16 R18 Y21 H25 F26 K27 R30 R62 F63 G65 G66 G68 R69 T70 A71 K74 R82 W83 P84 V85 K86 N97 A100 N101 Q118 V119 S141 A156 P158 K159	R2 Y3 K15 R17 Y20 H24 F25 K26 R29 R61 F62 G64 G65 G67 R68 T69 A70 K73 R81 W82 P83 V84 K85 N96 A99 N100 Q117 V118 S125 A140 P142 K143
BS02	rna	P	R3 S5 R61 N120 A121 P123 H145	R2 S4 R60 N119 A120 P122 H129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8euy, PDBe:8euy, PDBj:8euy
• PDBsum: 8euy
• PubMed: 36423630
• UniProt: O14339|RL17A_SCHPO Large ribosomal subunit protein uL22A (Gene Name=rpl1701)