Structure of PDB 8eui Chain P

Receptor sequence

>8euiP (length=173) Species: 4896 (Schizosaccharomyces pombe)

VRYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNV
KEHKQAVPFRRFNGGVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEAN
AEAKGLDMDKLIIKHVQVNAAPKQRRRTYRAHGRVTAYLSSPSHIEIIVA
EEEVSRVSLKQGAKARNLAARKA

3D structure

• PDB: 8eui Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: P
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R18 Y21 R23 H25 F26 K27 R30 K43 K55 R62 F63 G65 G66 V67 G68 R69 A71 Q72 K74 G77 T79 Q80 R82 W83 P84 V85 K86 N97 A100 N101 H116 Q118 V119 R127 T129 Y130 R131 A132 H133 G134 R135 V136 T137 A138 Y139 L140 S141 R166 S168 L169 K170 A173 K174 R176 N177 R181	R17 Y20 R22 H24 F25 K26 R29 K42 K54 R61 F62 G64 G65 V66 G67 R68 A70 Q71 K73 G76 T78 Q79 R81 W82 P83 V84 K85 N96 A99 N100 H115 Q117 V118 R126 T128 Y129 R130 A131 H132 G133 R134 V135 T136 A137 Y138 L139 S140 R156 S158 L159 K160 A163 K164 R166 N167 R171
BS02	rna	P	R3 Y4 S5 R30 R61 R62 N120 A121 P123 H145	R2 Y3 S4 R29 R60 R61 N119 A120 P122 H144

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eui, PDBe:8eui, PDBj:8eui
• PDBsum: 8eui
• PubMed: 36423630
• UniProt: O14339|RL17A_SCHPO Large ribosomal subunit protein uL22A (Gene Name=rpl1701)