Structure of PDB 8eu2 Chain P |
>8eu2P (length=79) [Search protein sequence] |
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT EHAKRKTVTAMDVVYALKRQGRTLYGFGG |
|
PDB | 8eu2 Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility. |
Chain | P |
Resolution | 2.93 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
P |
R45 I46 |
R22 I23 |
|
BS02 |
dna |
P |
T30 P32 |
T7 P9 |
|
|
|