Structure of PDB 8etj Chain P

Receptor sequence

>8etjP (length=156) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

YSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNVKE
HKQAVPFRRFNGGVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEANAE
AKGLDMDKLIIKHVQVNAAPKQLSSPSHIEIIVAEEESRVSLKQGAKARN
LAARKA

3D structure

PDB

8etj Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	K16 R18 Y21 R23 H25 F26 K27 R30 K43 K55 R62 F63 G65 G68 R69 A71 Q72 K74 T79 Q80 R82 W83 P84 V85 K86 N97 A100 N101 H116 Q118 V119 S141 R166 L169 K170 A173 K174 R176 R181	K13 R15 Y18 R20 H22 F23 K24 R27 K40 K52 R59 F60 G62 G65 R66 A68 Q69 K71 T76 Q77 R79 W80 P81 V82 K83 N94 A97 N98 H113 Q115 V116 S124 R139 L142 K143 A146 K147 R149 R154
BS02	rna	P	S5 R61 R62 N120 A121 P123 H145	S2 R58 R59 N117 A118 P120 H128

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8etj, PDBe:8etj, PDBj:8etj
PDBsum	8etj
PubMed	36423630
UniProt	O14339\|RL17A_SCHPO Large ribosomal subunit protein uL22A (Gene Name=rpl1701)

[Back to BioLiP]