Structure of PDB 8eth Chain P

Receptor sequence

>8ethP (length=130) Species: 4896 (Schizosaccharomyces pombe)

RYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNVK
EHKQAVPFRRFNGQARWPVKSVKFFYDLLKNAEANAEAKGLDMDKLIIKH
VQVNAAPKQSSPSHIEIIVAEEEEAVPKAN

3D structure

• PDB: 8eth Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: P
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 Y4 K16 A17 R18 Y21 H25 F26 K27 R30 R62 F63 G65 R82 W83 P84 V85 K86 N97 A100 N101 Q118 N120 K124 S142	R1 Y2 K14 A15 R16 Y19 H23 F24 K25 R28 R60 F61 G63 R66 W67 P68 V69 K70 N81 A84 N85 Q102 N104 K108 S111
BS02	rna	P	R3 S5 N120 A121 P123 H145	R1 S3 N104 A105 P107 H114

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eth, PDBe:8eth, PDBj:8eth
• PDBsum: 8eth
• PubMed: 36423630
• UniProt: O14339|RL17A_SCHPO Large ribosomal subunit protein uL22A (Gene Name=rpl1701)