Structure of PDB 8etc Chain P

Receptor sequence

>8etcP (length=169) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

VRYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNV
KEHKQAVPFRRFNGGVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEAN
AEAKGLDMDKLIIKHVQVNAAPKQRRRTYVTAYLSSPSHIEIIVAEEEET
VSRVSLKQGAKARNLAARK

3D structure

PDB

8etc Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 K16 R18 Y21 R23 H25 F26 K27 R30 K55 R62 F63 G65 G66 G68 R69 T70 A71 K74 T79 Q80 R82 W83 P84 V85 K86 N97 A100 N101 H116 Q118 V119 K124 R127 Y130 V136 T137 A138 Y139 L140 S141 R166 S168 L169 K170 K174 R176 N177 R181	R2 K15 R17 Y20 R22 H24 F25 K26 R29 K54 R61 F62 G64 G65 G67 R68 T69 A70 K73 T78 Q79 R81 W82 P83 V84 K85 N96 A99 N100 H115 Q117 V118 K123 R126 Y129 V130 T131 A132 Y133 L134 S135 R153 S155 L156 K157 K161 R163 N164 R168
BS02	rna	P	Y4 S5 R30 R61 R62 N120 P123	Y3 S4 R29 R60 R61 N119 P122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8etc, PDBe:8etc, PDBj:8etc
PDBsum	8etc
PubMed	36423630
UniProt	O14339\|RL17A_SCHPO Large ribosomal subunit protein uL22A (Gene Name=rpl1701)

[Back to BioLiP]