Structure of PDB 8cwo Chain P

Receptor sequence
>8cwoP (length=128) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
ATKIRLKRLGKIRTPHYRVVVMDSRAKRDGRAIEEIGQYHPKADPSVIVI
DSERVQYWLGVGAQPTEAVVALLKRTGDWQKFTGDTSPSGVKPQPERPNK
DDLFNAALAEADEAPREAITKKSEGAAA
3D structure
PDB8cwo Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
ChainP
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P A2 T3 K4 R6 L7 G11 K12 I13 R14 H17 Y18 R19 D24 S25 R26 K28 R29 R32 I34 H41 K43 S47 I49 V62 G63 Q65 T67 R76 G91 K93 P94 A1 T2 K3 R5 L6 G10 K11 I12 R13 H16 Y17 R18 D23 S24 R25 K27 R28 R31 I33 H40 K42 S46 I48 V61 G62 Q64 T66 R75 G90 K92 P93
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cwo, PDBe:8cwo, PDBj:8cwo
PDBsum8cwo
PubMed36864821
UniProtQ6A7S4|RS16_CUTAK Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]