Structure of PDB 8cta Chain P |
>8ctaP (length=52) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
IQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIR DY |
|
PDB | 8cta Structure of a HIV-1 IN-Allosteric inhibitor complex at 2.93 angstrom resolution: Routes to inhibitor optimization. |
Chain | P |
Resolution | 2.93 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
L3D |
P |
W235 K266 I268 |
W16 K47 I49 |
|
|
|
|