Structure of PDB 8csq Chain P

Receptor sequence
>8csqP (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
NEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHI
TGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNI
3D structure
PDB8csq Principles of mitoribosomal small subunit assembly in eukaryotes.
ChainP
Resolution2.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P I91 G93 R94 H95 Q104 T108 K112 R113 I116 I45 G47 R48 H49 Q58 T62 K66 R67 I70
BS02 FES P K64 C65 C68 C100 K103 K18 C19 C22 C54 K57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8csq, PDBe:8csq, PDBj:8csq
PDBsum8csq
PubMed36482135
UniProtQ9Y3D5|RT18C_HUMAN Small ribosomal subunit protein bS18m (Gene Name=MRPS18C)

[Back to BioLiP]