Structure of PDB 8cdu Chain P

Receptor sequence

>8cduP (length=88) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

AVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKI
DEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAKQG

3D structure

• PDB: 8cdu Structural basis of ribosomal 30S subunit degradation by RNase R
• Chain: P
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	A2 V3 K4 R6 L7 R9 G11 A12 K13 K14 F17 Y18 R19 S25 R26 P28 R29 G31 R32 V43 K45 T62 G63 K65 S67 T69 R71 N72 S75 M80 E81 H84 Q88	A1 V2 K3 R5 L6 R8 G10 A11 K12 K13 F16 Y17 R18 S24 R25 P27 R28 G30 R31 V42 K44 T61 G62 K64 S66 T68 R70 N71 S74 M79 E80 H83 Q87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cdu, PDBe:8cdu, PDBj:8cdu
• PDBsum: 8cdu
• PubMed: 38326618
• UniProt: P21474|RS16_BACSU Small ribosomal subunit protein bS16 (Gene Name=rpsP)