Structure of PDB 8bf9 Chain P

Receptor sequence

>8bf9P (length=151) Species: 9940 (Ovis aries) [Search protein sequence]

YSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTL
KKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAE
LKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILTEK
E

3D structure

PDB

8bf9 Molecular view of ER membrane remodeling by the Sec61/TRAP translocon.

Chain

Resolution

2.69 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	Y4 K16 R18 S20 R23 H25 F26 K27 Q34 K37 R62 Y63 G65 G66 G68 R69 W78 T79 Q80 R82 W83 P84 K85 K86 N97 S100 N101 L104 Q118 V119 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 P138 Y139 M140 S141	Y1 K13 R15 S17 R20 H22 F23 K24 Q31 K34 R59 Y60 G62 G63 G65 R66 W75 T76 Q77 R79 W80 P81 K82 K83 N94 S97 N98 L101 Q115 V116 R124 T126 Y127 R128 A129 H130 G131 R132 I133 N134 P135 Y136 M137 S138

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bf9, PDBe:8bf9, PDBj:8bf9
PDBsum	8bf9
PubMed	37983950
UniProt	K4P217

[Back to BioLiP]