Structure of PDB 8b5l Chain P

Receptor sequence

>8b5lP (length=153) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKE

3D structure

PDB

8b5l Structural insights into TRAP association with ribosome-Sec61 complex and translocon inhibition by a CADA derivative.

Chain

Resolution

2.86 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 Y4 K16 R18 G19 R23 H25 K27 R30 Q34 K37 K43 R62 Y63 N64 G65 G66 G68 R69 A71 Q72 K74 Q80 R82 W83 P84 K85 K86 N97 S100 N101 L104 Q118 V119 R127 T129 Y130 R131 A132 H133 G134 I136 N137 P138 Y139 M140 S141	R2 Y3 K15 R17 G18 R22 H24 K26 R29 Q33 K36 K42 R61 Y62 N63 G64 G65 G67 R68 A70 Q71 K73 Q79 R81 W82 P83 K84 K85 N96 S99 N100 L103 Q117 V118 R126 T128 Y129 R130 A131 H132 G133 I135 N136 P137 Y138 M139 S140
BS02	rna	P	S5 R61 R62 W78 N120 K121 P123	S4 R60 R61 W77 N119 K120 P122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8b5l, PDBe:8b5l, PDBj:8b5l
PDBsum	8b5l
PubMed	36867692
UniProt	G1SCJ6\|RL17_RABIT Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]