Structure of PDB 8a05 Chain P |
>8a05P (length=91) Species: 908820 (Flavobacterium phage FL-1) [Search protein sequence] |
MNFIQYIDDSYAVKVKEINSSEGFYINGIQTPFFILSVFIGNKRVTGVEF NNYDSLPMLSVINDLGNIDLNVIPQNYFATAFTEIYFNIPF |
|
PDB | 8a05 Cryo-EM structure of ssDNA bacteriophage Phi CjT23 provides insight into early virus evolution. |
Chain | P |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
P |
I68 L70 N71 |
I68 L70 N71 |
|
|
|